DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33453

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:167 Identity:99/167 - (59%)
Similarity:125/167 - (74%) Gaps:7/167 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AAFVVSVILGFLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNI 70
            |.|::|.:      .|||..|:||.||:|.||||.|.||||||||||.||||||||||:.|..|:
  Fly    14 ALFLISSV------SEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLHPTNNV 72

  Fly    71 YLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFH 135
            .|.:||:|:.:||||||||.|.|||:|:|:|:.|..|:.::.||:.||:|||||| |||::||:|
  Fly    73 SLRLKMVKRLSGYKPFLFDVTIDACQFLRKRHNPVIKMFYSFIKDYSTLNHTCPY-GLQVVSDYH 136

  Fly   136 HIDVPVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVE 172
            ....|||||||||.:|||:||..|.||..|:||.|||
  Fly   137 TAVFPVPLPSGDYGVLLDFIFYAKKQFHVNIYFNFVE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 52/87 (60%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 44/75 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471893
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108326at33392
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
98.900

Return to query results.
Submit another query.