DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33454

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:161 Identity:92/161 - (57%)
Similarity:120/161 - (74%) Gaps:7/161 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VILG------FLVCGEAPLAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNI 70
            :|||      |||..::.:.||||.||:||:||..|.|||||||||||||||:|||||:.|..:|
  Fly     6 IILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLHPINSI 70

  Fly    71 YLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFH 135
            .:..:|:|:||||||||||.|.|||:|:|:.|.|..|||:||||:.|.:||:||| |..:|:|||
  Fly    71 SVRFQMLKRANGYKPFLFDITVDACQFLRKPNNPVIKIVYNMIKDASNINHSCPY-GTVVLNDFH 134

  Fly   136 HIDVPVPLPSGDYLLLLDWIFDFKPQFATNV 166
            .|.:|:|.||||||..||::.:.|.:|..||
  Fly   135 RISLPLPFPSGDYLSRLDFLINGKTKFYVNV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 48/84 (57%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 45/76 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471892
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.