DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33467

DIOPT Version :9

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:158 Identity:43/158 - (27%)
Similarity:72/158 - (45%) Gaps:15/158 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIEPAKNIYLHMKMMKK--ANGYKPFLF 88
            |.|...|:. |::.|....|.:|..:.....:|::...|.|..|..:.:::..|  :|.|||||.
  Fly    25 KFTKVECQG-NQARVKNVSCNVKPINWNTALVNLDCYLIYPLINPTIRVQVFMKDYSNQYKPFLI 88

  Fly    89 DYTFDACEFMRRRN-QPFAKIVWNMIKNVSTVNHTCPYEG-LQMLSDFHHIDVPVPLPSGDYLLL 151
            |.||..|:.:.|:| .|:|.:||.:.:..:.|. :|...| |...:.:.:.....|.|.|.|.:.
  Fly    89 DATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSARNGYLNSSYVPPFPHGQYQIS 152

  Fly   152 LDWIFDFKPQFATNVYFT-----FVEGM 174
            :    .|....:||..|.     ||:.|
  Fly   153 V----MFSDSNSTNREFVGIVKFFVQAM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 27/94 (29%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471926
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.