DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG33477

DIOPT Version :10

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:117 Identity:23/117 - (19%)
Similarity:39/117 - (33%) Gaps:52/117 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IEPAKNIYLHMKMMK------KANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHT 122
            :.||..|.:.:|::|      |...:|         .|||:   |.|   :::.|...       
  Fly    86 LAPAFTINITIKVLKTHRIMYKIENFK---------GCEFL---NNP---VIFKMFGE------- 128

  Fly   123 CPYEGLQMLSDFHHIDVPVPLPSGDYLLLLDWIFDFKPQFATNVYFTFVEGM 174
             .|:.|              :.:|.|         ||.....|||:...:|:
  Fly   129 -SYKTL--------------VVNGSY---------FKCPIKPNVYYLKTDGI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 16/87 (18%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 19/103 (18%)

Return to query results.
Submit another query.