DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13589 and CG30050

DIOPT Version :10

Sequence 1:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_725159.2 Gene:CG30050 / 246417 FlyBaseID:FBgn0050050 Length:192 Species:Drosophila melanogaster


Alignment Length:172 Identity:44/172 - (25%)
Similarity:72/172 - (41%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GFLVCG--EAPLAK----------MTNAVCKSYNKSWVVVHYCR-LKAYSRT-KTSLNINATFIE 65
            |.:||.  .|..||          |....|.. |.::....||| :...:|| :.|:||......
  Fly     9 GIIVCSLDTADTAKLIPNMGYYIEMKQMDCVG-NPNYFANLYCRIIPPKNRTMEASVNIMQQLSV 72

  Fly    66 PAKNIYLHMKMMKKANGYKPFLFDYTFDACEFMRRRNQPFAKIVWNMIKNVSTVNHT-----CPY 125
            .:.::.:.:...||....   :||.|||.|:.:|.|.:   ||:.:::.|....|..     ||:
  Fly    73 FSGSLRVSIPNAKKVITQ---IFDITFDVCKVLRERKR---KILIDLLVNTLAKNSNAKAWRCPF 131

  Fly   126 -EGLQMLSDFHHIDVPVPLPSGDYLLLLDWIFDFKPQFATNV 166
             :|.....:....|:|..|...::.:.||: |..|...|.||
  Fly   132 PKGKFESRNISVTDLPPMLTESEFFVNLDF-FIPKVAIAMNV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13589NP_611918.2 DM8 83..171 CDD:214778 25/90 (28%)
CG30050NP_725159.2 DM8 90..177 CDD:214778 25/90 (28%)

Return to query results.
Submit another query.