DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13579 and htr1ab

DIOPT Version :9

Sequence 1:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001139238.1 Gene:htr1ab / 797538 ZFINID:ZDB-GENE-090409-2 Length:403 Species:Danio rerio


Alignment Length:420 Identity:98/420 - (23%)
Similarity:166/420 - (39%) Gaps:103/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AVLILVLTL-GVIGANCLVIFVINNRRYAAYIHQQPRYLLTSLALNDLTIGLLITPFGLMPALFH 104
            ::||..|.| .:.|..|:|..:...|.    :.....||:.|||:.||.:.:|:.|...:..:..
Zfish    39 SLLIGALILCSIFGNACVVAAIALERS----LQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLD 99

  Fly   105 CWPYGEIFCQIQALLRGALSQQSAVILVCMAVDRYMCALHPRRYYQHSSKKGCVAILSLTWII-- 167
            .|..|::.|.|...|.......|.:.|..:|:|||.....|..|.:..:.|....::::||.:  
Zfish   100 KWTLGQVTCDIFISLDILCCTSSILHLCAIALDRYWAITDPIDYMKKRTLKRAALLITVTWFVGF 164

  Fly   168 SLTVFGFLVL---PKGYYFNNTGLMACEPFYSKPSYRILST-CALYFPTTMVLMYCYGSSFHMSR 228
            |:::...|::   ||      |.:::.:|:|:     |.|| ||.|.|..::|: .||..|..:|
Zfish   165 SISIPPMLIMKSQPK------TCMISHDPWYT-----IYSTFCAFYIPLILMLV-LYGRIFKAAR 217

  Fly   229 FRLN----------------DPTMPLTA---------AAHHPHPHPHPTAAQQLQMHQHQQHHQQ 268
            ||:.                .|.:...|         :|..|.|......|.:         |.:
Zfish   218 FRIRKTVRKPEKKRVKCLTVSPALFKRANGELSKNWKSAVEPKPAACVNGAIK---------HAE 273

  Fly   269 AGMHSHLYHGHSHHPSHPSHPNHPNHHGHPHHHGPPVMGHLSMAMSMGLAGMPNMTNKITKKIVP 333
            .|....:...||:..::...||.||                         .:|...||       
Zfish   274 DGESLEIIEVHSNSKNNLPLPNTPN-------------------------SVPLFENK------- 306

  Fly   334 IQEKNSSGSTSRSMA---------AISLG-FIVMVTPWTIQEIVTA-CTGSKLPPFLDFLVTWTA 387
             .|||:......::|         .|.:| ||:...|:.|:.:|.. |....:|.:|..::.|..
Zfish   307 -HEKNTEAKRKLALARERKTVKTLGIIMGTFILCWLPFFIKALVMPFCPTCVMPLWLQDVINWLG 370

  Fly   388 LSNSLWNPFMYWLLNSDFRRMSRQLMPNKC 417
            .||||.||.:|...|.||:...::::  ||
Zfish   371 YSNSLLNPIIYAYFNKDFQSAFKKII--KC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 25/96 (26%)
htr1abNP_001139238.1 7tm_4 46..>208 CDD:304433 45/177 (25%)
7tm_1 52..381 CDD:278431 88/386 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.