DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13579 and AstA-R2

DIOPT Version :9

Sequence 1:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001263042.1 Gene:AstA-R2 / 43393 FlyBaseID:FBgn0039595 Length:357 Species:Drosophila melanogaster


Alignment Length:163 Identity:43/163 - (26%)
Similarity:71/163 - (43%) Gaps:11/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVKNSSCSHPRYSGHNFIAHIGIAETIEAVLILVLTLGVIGANCLVIFVI---NNRRYAAYIHQQ 74
            |.:|.......::...::|..|....|......|:.:.....|.|||.|:   ||.|....:   
  Fly    14 ATRNEENITSFFTDEEWLAINGTLPWIVGFFFGVIAITGFFGNLLVILVVVFNNNMRSTTNL--- 75

  Fly    75 PRYLLTSLALNDLTIGLLITPFGLMPALFHCWPYGEIFCQIQALLRGALSQQSAVILVCMAVDRY 139
               ::.:||..||...:|..||.....:.:.||||..:|:....|....:..|...||.|::||:
  Fly    76 ---MIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRF 137

  Fly   140 MCALHP-RRYYQHSSKKGCVAILSLTWIISLTV 171
            :..:|| |.....:.....:||::| ||:.|.|
  Fly   138 LAVVHPIRSRMMRTENITLIAIVTL-WIVVLVV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 30/100 (30%)
AstA-R2NP_001263042.1 7tm_4 47..>164 CDD:304433 34/123 (28%)
7tm_1 55..313 CDD:278431 37/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24230
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.