DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13579 and Olfr685

DIOPT Version :9

Sequence 1:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001011857.1 Gene:Olfr685 / 258160 MGIID:3030519 Length:316 Species:Mus musculus


Alignment Length:304 Identity:75/304 - (24%)
Similarity:112/304 - (36%) Gaps:57/304 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AVKNSSCSHPRYSGHNFIAHIGIAETIEAVLILVLTLGV-----IGANCLVIFVINNRRYAAYIH 72
            |:.|||...|:   ..|.. :|:....|:...:.|.||:     :..|..:||:|..   .:.:|
Mouse     2 ALSNSSWRQPQ---PPFFL-VGVPGLEESQHWIALPLGILYLFALVGNVTIIFIIWT---DSSLH 59

  Fly    73 QQPRYL-LTSLALNDLTIGLLITPFGLMPALFHCWPYGEIFCQIQALLRGALSQQSAVILVCMAV 136
             ||.|| |..||..||.:.....|..|...|.|....|.|.|..|.....|.|...:.|||.||:
Mouse    60 -QPMYLFLAMLAAIDLVLASSTAPKALTVLLAHAHEIGYIVCLTQMFFIHAFSSMESGILVAMAL 123

  Fly   137 DRYMCALHPRRYYQHSS--KKGCVAILSLTWIIS--LTVFGFLVLPKGYYFNNTGLMA---CEPF 194
            |||:...||.|   ||:  ..|.:..:.|..::.  :.:|.|.:|.:...|....:::   ||..
Mouse   124 DRYVAICHPLR---HSTILHPGIIGRIGLVVLVRGLVLLFPFPILLQNVVFCRATVISHAYCEHM 185

  Fly   195 YSKPSYRILSTCALYFPTTMVLMYC--------YGSSFHMSRFRLNDPTMPLTAAAHHPHPHPHP 251
                              .:|.:.|        ||.|..:....|:...:.::.|.........|
Mouse   186 ------------------AVVKLACSETTVNRAYGLSVALLVVGLDVLAIGISYALILQAVLKVP 232

  Fly   252 TAAQQLQMHQHQQHH-------QQAGMHSHLYHGHSHHPSHPSH 288
            ....:|:.......|       ...||.|.|.|...||..|..|
Mouse   233 GGEARLKAFSTCGSHVCVILIFYVPGMFSFLTHRFGHHVPHHVH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 34/102 (33%)
Olfr685NP_001011857.1 7tm_4 37..313 CDD:304433 64/265 (24%)
7tm_1 44..295 CDD:278431 64/258 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11804
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.