DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13579 and or4a5

DIOPT Version :9

Sequence 1:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_012813728.2 Gene:or4a5 / 105946689 XenbaseID:XB-GENE-22068816 Length:201 Species:Xenopus tropicalis


Alignment Length:106 Identity:28/106 - (26%)
Similarity:42/106 - (39%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 MAVDRYMCALHPRRYYQHSSKKGCVAILSLTWIISLTVFGFLVLPK-----------GYYFNNTG 187
            ||.|||:|..:|.||....|......||:.:|..|:..||..:|..           ..|.:|..
 Frog     1 MAFDRYVCICNPLRYNTIMSHSTVYKILAGSWTYSIVAFGTHILLTYRLPLCGAEILKIYCDNWS 65

  Fly   188 L--MACEPFYSKPSYRILSTCALYFPTT------MVLMYCY 220
            :  ::|      ....|.:...|:..||      |::||.|
 Frog    66 IVRLSC------IDTTINNVFGLFIVTTFVCMLLMLIMYSY 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 7/13 (54%)
or4a5XP_012813728.2 7tm_GPCRs <1..185 CDD:421689 28/106 (26%)
TM helix 4 23..44 CDD:410628 6/20 (30%)
TM helix 5 77..107 CDD:410628 7/24 (29%)
TM helix 6 113..143 CDD:410628
TM helix 7 153..178 CDD:410628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D319105at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.