DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16837 and Dynlrb1

DIOPT Version :10

Sequence 1:NP_611916.1 Gene:CG16837 / 37904 FlyBaseID:FBgn0035009 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001278037.1 Gene:Dynlrb1 / 67068 MGIID:1914318 Length:104 Species:Mus musculus


Alignment Length:82 Identity:29/82 - (35%)
Similarity:52/82 - (63%) Gaps:0/82 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LFAHRGARDIMILDSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPSNDITFMRIRSNM 102
            |.:.:|.:.|:::::.|:|::||.....|..:.:.:...:..||:.||::||.||:||:||||..
Mouse    19 LQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKK 83

  Fly   103 GEIHMTLGTDFILIVVQ 119
            .||.:....|:.|||:|
Mouse    84 NEIMVAPDKDYFLIVIQ 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16837NP_611916.1 Robl_LC7 30..119 CDD:397386 28/80 (35%)
Dynlrb1NP_001278037.1 Robl_LC7 12..99 CDD:214939 27/79 (34%)

Return to query results.
Submit another query.