DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16837 and CG10822

DIOPT Version :9

Sequence 1:NP_611916.1 Gene:CG16837 / 37904 FlyBaseID:FBgn0035009 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster


Alignment Length:97 Identity:21/97 - (21%)
Similarity:50/97 - (51%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RSRSYDGDAFVNLFAHRGARDIMILDSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDPS 90
            |::||..:.|..:....|..||:|::..|||::::..::....:......|....:..:..::|:
  Fly    10 RTKSYVEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPA 74

  Fly    91 NDITFMRIRSNMGEIHMTLGTDFILIVVQKLR 122
            .::|.:|:|:...|:.:|......::|||..:
  Fly    75 QNLTLLRVRTKYHEVLITPDAKITVLVVQNAK 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16837NP_611916.1 Robl_LC7 35..119 CDD:281277 16/83 (19%)
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.