DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16837 and CG31275

DIOPT Version :10

Sequence 1:NP_611916.1 Gene:CG16837 / 37904 FlyBaseID:FBgn0035009 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_732175.1 Gene:CG31275 / 326131 FlyBaseID:FBgn0063261 Length:101 Species:Drosophila melanogaster


Alignment Length:95 Identity:25/95 - (26%)
Similarity:38/95 - (40%) Gaps:30/95 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IRSRSYDGDAFVNLFAHRGARDIMILDSHGVPLRSTCSQRRTFVFVSNLKPLLFMARNVVRDLDP 89
            :...|:|..:...:..|          .||: |.|||                   ::||||:||
  Fly    37 VAETSFDNTSAQAILKH----------LHGL-LVSTC-------------------QSVVRDIDP 71

  Fly    90 SNDITFMRIRSNMGEIHMTLGTDFILIVVQ 119
            ||.:.|||:.:...|..:.....|.:.|||
  Fly    72 SNKLCFMRLGTRKFEYLVAPEEYFTITVVQ 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16837NP_611916.1 Robl_LC7 30..119 CDD:397386 22/88 (25%)
CG31275NP_732175.1 None

Return to query results.
Submit another query.