DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3494 and Lrrc40

DIOPT Version :9

Sequence 1:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_077156.2 Gene:Lrrc40 / 67144 MGIID:1914394 Length:602 Species:Mus musculus


Alignment Length:202 Identity:75/202 - (37%)
Similarity:115/202 - (56%) Gaps:2/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPT 102
            ::|..|..|.:.:|.::|:|.:..|:..::...|:|.|:|:.:..|.|.:..:.|:.|::||:..
Mouse   402 KLLDYSDKQATLIPDDLFDATKTTLITSINFSKNQLCEIPQRIVELKEMVLDINLSFNKLSFISH 466

  Fly   103 NISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIR 167
            .:....|||.|.|.||.|..||.|:..|..|:.:::|.|||:..|..:|.:..||.:...:||:.
Mouse   467 ELCLLQKLTFLDLRNNFLSSLPEEMSSLTKLQTINLSFNRFKVFPEVLYRISTLEAVLISNNQVG 531

  Fly   168 AIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLS 232
            ::|..:..|  |..|..|:|.|||:..:||.||....|..|.|.|||||.||..||..||.|:|.
Mouse   532 SVDPQKMKL--MENLNTLDLQNNDLLQIPPELGNCVQLRTLLLDGNPFRVPRAAILMKGTAAVLE 594

  Fly   233 YLRTRIP 239
            |||.|||
Mouse   595 YLRDRIP 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3494NP_611915.1 LRR <34..>231 CDD:227223 68/192 (35%)
leucine-rich repeat 38..62 CDD:275380 6/23 (26%)
leucine-rich repeat 63..86 CDD:275380 5/22 (23%)
LRR_4 85..124 CDD:289563 13/38 (34%)
leucine-rich repeat 87..109 CDD:275380 4/21 (19%)
leucine-rich repeat 110..133 CDD:275380 11/22 (50%)
leucine-rich repeat 134..155 CDD:275380 6/20 (30%)
leucine-rich repeat 156..181 CDD:275380 7/24 (29%)
leucine-rich repeat 182..204 CDD:275380 10/21 (48%)
Lrrc40NP_077156.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
LRR 1 35..58
leucine-rich repeat 38..83 CDD:275380
LRR 2 81..103
LRR_8 84..140 CDD:290566
leucine-rich repeat 84..106 CDD:275380
LRR_RI 101..368 CDD:238064
LRR 3 104..126
leucine-rich repeat 107..129 CDD:275380
LRR 4 127..149
LRR_8 129..186 CDD:290566
leucine-rich repeat 130..152 CDD:275380
LRR 5 150..172
leucine-rich repeat 153..175 CDD:275380
LRR 6 174..195
leucine-rich repeat 176..221 CDD:275380
LRR 7 196..219
LRR_8 220..277 CDD:290566
LRR 8 221..241
leucine-rich repeat 222..244 CDD:275380
LRR 9 242..266
leucine-rich repeat 245..266 CDD:275380
LRR_RI 248..505 CDD:238064 31/102 (30%)
LRR_8 265..324 CDD:290566
leucine-rich repeat 267..290 CDD:275380
LRR 10 268..287
LRR 11 288..310
leucine-rich repeat 291..313 CDD:275380
LRR 12 311..334
LRR 13 336..356
leucine-rich repeat 365..473 CDD:275380 17/70 (24%)
LRR 14 398..421 5/18 (28%)
LRR 15 424..447 5/22 (23%)
LRR 16 449..470 5/20 (25%)
LRR_8 454..507 CDD:290566 19/52 (37%)
LRR 17 471..494 11/22 (50%)
LRR 18 496..517 7/20 (35%)
leucine-rich repeat 497..519 CDD:275380 7/21 (33%)
LRR_8 518..577 CDD:290566 22/60 (37%)
LRR 19 519..540 5/20 (25%)
leucine-rich repeat 520..543 CDD:275380 7/24 (29%)
LRR 20 541..564 11/22 (50%)
LRR 21 566..587 12/20 (60%)
leucine-rich repeat 567..578 CDD:275378 6/10 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0472
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005608
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.