Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_077156.2 | Gene: | Lrrc40 / 67144 | MGIID: | 1914394 | Length: | 602 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 75/202 - (37%) |
---|---|---|---|
Similarity: | 115/202 - (56%) | Gaps: | 2/202 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 RILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPT 102
Fly 103 NISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIR 167
Fly 168 AIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLS 232
Fly 233 YLRTRIP 239 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 68/192 (35%) |
leucine-rich repeat | 38..62 | CDD:275380 | 6/23 (26%) | ||
leucine-rich repeat | 63..86 | CDD:275380 | 5/22 (23%) | ||
LRR_4 | 85..124 | CDD:289563 | 13/38 (34%) | ||
leucine-rich repeat | 87..109 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 110..133 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 134..155 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 156..181 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 182..204 | CDD:275380 | 10/21 (48%) | ||
Lrrc40 | NP_077156.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..26 | ||
LRR 1 | 35..58 | ||||
leucine-rich repeat | 38..83 | CDD:275380 | |||
LRR 2 | 81..103 | ||||
LRR_8 | 84..140 | CDD:290566 | |||
leucine-rich repeat | 84..106 | CDD:275380 | |||
LRR_RI | 101..368 | CDD:238064 | |||
LRR 3 | 104..126 | ||||
leucine-rich repeat | 107..129 | CDD:275380 | |||
LRR 4 | 127..149 | ||||
LRR_8 | 129..186 | CDD:290566 | |||
leucine-rich repeat | 130..152 | CDD:275380 | |||
LRR 5 | 150..172 | ||||
leucine-rich repeat | 153..175 | CDD:275380 | |||
LRR 6 | 174..195 | ||||
leucine-rich repeat | 176..221 | CDD:275380 | |||
LRR 7 | 196..219 | ||||
LRR_8 | 220..277 | CDD:290566 | |||
LRR 8 | 221..241 | ||||
leucine-rich repeat | 222..244 | CDD:275380 | |||
LRR 9 | 242..266 | ||||
leucine-rich repeat | 245..266 | CDD:275380 | |||
LRR_RI | 248..505 | CDD:238064 | 31/102 (30%) | ||
LRR_8 | 265..324 | CDD:290566 | |||
leucine-rich repeat | 267..290 | CDD:275380 | |||
LRR 10 | 268..287 | ||||
LRR 11 | 288..310 | ||||
leucine-rich repeat | 291..313 | CDD:275380 | |||
LRR 12 | 311..334 | ||||
LRR 13 | 336..356 | ||||
leucine-rich repeat | 365..473 | CDD:275380 | 17/70 (24%) | ||
LRR 14 | 398..421 | 5/18 (28%) | |||
LRR 15 | 424..447 | 5/22 (23%) | |||
LRR 16 | 449..470 | 5/20 (25%) | |||
LRR_8 | 454..507 | CDD:290566 | 19/52 (37%) | ||
LRR 17 | 471..494 | 11/22 (50%) | |||
LRR 18 | 496..517 | 7/20 (35%) | |||
leucine-rich repeat | 497..519 | CDD:275380 | 7/21 (33%) | ||
LRR_8 | 518..577 | CDD:290566 | 22/60 (37%) | ||
LRR 19 | 519..540 | 5/20 (25%) | |||
leucine-rich repeat | 520..543 | CDD:275380 | 7/24 (29%) | ||
LRR 20 | 541..564 | 11/22 (50%) | |||
LRR 21 | 566..587 | 12/20 (60%) | |||
leucine-rich repeat | 567..578 | CDD:275378 | 6/10 (60%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0472 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0005608 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |