| Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001153082.1 | Gene: | Lrrc57 / 66606 | MGIID: | 1913856 | Length: | 281 | Species: | Mus musculus |
| Alignment Length: | 214 | Identity: | 61/214 - (28%) |
|---|---|---|---|
| Similarity: | 101/214 - (47%) | Gaps: | 33/214 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 QVSKAQISEVPMEVFEAAQQEL--------------------VNIVSLDGNRLLEMPKDLPLLSE 85
Fly 86 HLTQLVLNKNQI-SFVPTNISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRC 149
Fly 150 IYELERLETLSAHDNQIRAIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNP 214
Fly 215 FRQ--------PRHQILSM 225 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 61/214 (29%) |
| leucine-rich repeat | 38..62 | CDD:275380 | 3/20 (15%) | ||
| leucine-rich repeat | 63..86 | CDD:275380 | 6/22 (27%) | ||
| LRR_4 | 85..124 | CDD:289563 | 14/39 (36%) | ||
| leucine-rich repeat | 87..109 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 110..133 | CDD:275380 | 12/22 (55%) | ||
| leucine-rich repeat | 134..155 | CDD:275380 | 6/20 (30%) | ||
| leucine-rich repeat | 156..181 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 182..204 | CDD:275380 | 6/21 (29%) | ||
| Lrrc57 | NP_001153082.1 | LRR | <62..>211 | CDD:227223 | 53/152 (35%) |
| leucine-rich repeat | 82..105 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 106..128 | CDD:275380 | 12/21 (57%) | ||
| leucine-rich repeat | 129..151 | CDD:275380 | 7/21 (33%) | ||
| leucine-rich repeat | 152..174 | CDD:275380 | 8/24 (33%) | ||
| leucine-rich repeat | 175..197 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 198..219 | CDD:275380 | 5/20 (25%) | ||
| leucine-rich repeat | 220..241 | CDD:275380 | 1/6 (17%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||