DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3494 and si:dkey-1h4.4

DIOPT Version :9

Sequence 1:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_021333533.1 Gene:si:dkey-1h4.4 / 566734 ZFINID:ZDB-GENE-160728-41 Length:251 Species:Danio rerio


Alignment Length:204 Identity:60/204 - (29%)
Similarity:97/204 - (47%) Gaps:25/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EVPMEVFEAAQQELVNI--------------------VSLDGNRLLEMPKDLPLLSEHLTQLVLN 93
            ::.:|.|. .|||.:|:                    :.|:.|:|: :|.|..|..|.|.:|:|:
Zfish     5 DMVLECFN-KQQESLNMSHRGLVVLPPGVSRLVTLKKLFLNNNQLI-LPPDEILHLEKLEELILD 67

  Fly    94 KNQISFVPTNISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLET 158
            :||::.:|:||.....||.|.:::|.|..||..||.|..||.|.........||..|.:|.:|:.
Zfish    68 RNQLTMLPSNIGSLKHLTYLGINHNPLSVLPEALGDLTELRELWAVGCGLISLPSSIGKLSKLQK 132

  Fly   159 LSAHDNQIRAIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQIL 223
            |..|:|.|..:   .|..|.:..|:.|||.:|.:|.:|..:..:.:||.:.|..|.|......:.
Zfish   133 LGVHNNIITNL---PSQFGSLSNLQWLNLADNKLQDLPEDINHLPSLVFINLDKNCFTDIPTVLT 194

  Fly   224 SMGTPALLS 232
            .|....:||
Zfish   195 DMANLQILS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3494NP_611915.1 LRR <34..>231 CDD:227223 58/201 (29%)
leucine-rich repeat 38..62 CDD:275380 4/12 (33%)
leucine-rich repeat 63..86 CDD:275380 7/42 (17%)
LRR_4 85..124 CDD:289563 14/38 (37%)
leucine-rich repeat 87..109 CDD:275380 8/21 (38%)
leucine-rich repeat 110..133 CDD:275380 10/22 (45%)
leucine-rich repeat 134..155 CDD:275380 6/20 (30%)
leucine-rich repeat 156..181 CDD:275380 7/24 (29%)
leucine-rich repeat 182..204 CDD:275380 7/21 (33%)
si:dkey-1h4.4XP_021333533.1 leucine-rich repeat 16..34 CDD:275380 2/17 (12%)
LRR <32..>238 CDD:227223 54/176 (31%)
leucine-rich repeat 38..60 CDD:275380 6/22 (27%)
leucine-rich repeat 61..83 CDD:275380 8/21 (38%)
leucine-rich repeat 84..106 CDD:275380 10/21 (48%)
leucine-rich repeat 107..129 CDD:275380 7/21 (33%)
leucine-rich repeat 130..152 CDD:275380 7/24 (29%)
leucine-rich repeat 153..175 CDD:275380 7/21 (33%)
leucine-rich repeat 176..198 CDD:275380 6/21 (29%)
leucine-rich repeat 199..222 CDD:275380 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45367
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.