| Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060238.3 | Gene: | LRRC40 / 55631 | HGNCID: | 26004 | Length: | 602 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 81/202 - (40%) |
|---|---|---|---|
| Similarity: | 119/202 - (58%) | Gaps: | 2/202 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 RILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPT 102
Fly 103 NISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIR 167
Fly 168 AIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLS 232
Fly 233 YLRTRIP 239 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 74/192 (39%) |
| leucine-rich repeat | 38..62 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 63..86 | CDD:275380 | 7/22 (32%) | ||
| LRR_4 | 85..124 | CDD:289563 | 13/38 (34%) | ||
| leucine-rich repeat | 87..109 | CDD:275380 | 4/21 (19%) | ||
| leucine-rich repeat | 110..133 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 134..155 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 156..181 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 182..204 | CDD:275380 | 10/21 (48%) | ||
| LRRC40 | NP_060238.3 | leucine-rich repeat | 41..83 | CDD:275380 | |
| LRR 1 | 83..104 | ||||
| LRR_8 | 84..140 | CDD:316378 | |||
| leucine-rich repeat | 84..106 | CDD:275380 | |||
| LRR 2 | 106..127 | ||||
| leucine-rich repeat | 107..129 | CDD:275380 | |||
| PLN00113 | 120..>577 | CDD:331614 | 64/176 (36%) | ||
| LRR 3 | 129..150 | ||||
| leucine-rich repeat | 130..152 | CDD:275380 | |||
| LRR 4 | 152..173 | ||||
| leucine-rich repeat | 153..175 | CDD:275380 | |||
| LRR 5 | 175..196 | ||||
| leucine-rich repeat | 176..198 | CDD:275380 | |||
| LRR 6 | 198..219 | ||||
| leucine-rich repeat | 199..221 | CDD:275380 | |||
| LRR 7 | 221..242 | ||||
| leucine-rich repeat | 222..244 | CDD:275380 | |||
| LRR 8 | 244..265 | ||||
| leucine-rich repeat | 245..266 | CDD:275380 | |||
| LRR 9 | 266..286 | ||||
| leucine-rich repeat | 267..290 | CDD:275380 | |||
| LRR 10 | 290..311 | ||||
| leucine-rich repeat | 291..313 | CDD:275380 | |||
| LRR 11 | 313..335 | ||||
| LRR 12 | 336..356 | ||||
| LRR 13 | 400..421 | 8/18 (44%) | |||
| LRR 14 | 426..447 | 6/20 (30%) | |||
| leucine-rich repeat | 447..473 | CDD:275380 | 6/25 (24%) | ||
| LRR 15 | 450..472 | 4/21 (19%) | |||
| LRR 16 | 473..494 | 11/20 (55%) | |||
| leucine-rich repeat | 474..496 | CDD:275380 | 11/21 (52%) | ||
| LRR 17 | 496..517 | 8/20 (40%) | |||
| leucine-rich repeat | 497..543 | CDD:275380 | 15/47 (32%) | ||
| LRR 18 | 519..540 | 6/20 (30%) | |||
| LRR 19 | 543..564 | 10/20 (50%) | |||
| leucine-rich repeat | 544..566 | CDD:275380 | 10/21 (48%) | ||
| LRR 20 | 566..586 | 12/19 (63%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0472 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D295141at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0005608 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.820 | |||||