| Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_060238.3 | Gene: | LRRC40 / 55631 | HGNCID: | 26004 | Length: | 602 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 81/202 - (40%) |
|---|---|---|---|
| Similarity: | 119/202 - (58%) | Gaps: | 2/202 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 38 RILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPT 102
Fly 103 NISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIR 167
Fly 168 AIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLS 232
Fly 233 YLRTRIP 239 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3494 | NP_611915.1 | LRR | <32..>215 | CDD:443914 | 64/176 (36%) |
| leucine-rich repeat | 38..62 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 63..86 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 87..109 | CDD:275380 | 4/21 (19%) | ||
| leucine-rich repeat | 110..133 | CDD:275380 | 11/22 (50%) | ||
| leucine-rich repeat | 134..155 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 156..181 | CDD:275380 | 7/24 (29%) | ||
| leucine-rich repeat | 182..204 | CDD:275380 | 10/21 (48%) | ||
| LRRC40 | NP_060238.3 | LRR 8 | 244..265 | ||
| leucine-rich repeat | 245..266 | CDD:275380 | |||
| LRR 9 | 266..286 | ||||
| leucine-rich repeat | 267..290 | CDD:275380 | |||
| LRR 10 | 290..311 | ||||
| leucine-rich repeat | 291..313 | CDD:275380 | |||
| LRR 11 | 313..335 | ||||
| LRR 12 | 336..356 | ||||
| LRR 13 | 400..421 | 8/18 (44%) | |||
| LRR 14 | 426..447 | 6/20 (30%) | |||
| leucine-rich repeat | 447..473 | CDD:275380 | 6/25 (24%) | ||
| LRR 15 | 450..472 | 4/21 (19%) | |||
| LRR 16 | 473..494 | 11/20 (55%) | |||
| leucine-rich repeat | 474..496 | CDD:275380 | 11/21 (52%) | ||
| LRR 17 | 496..517 | 8/20 (40%) | |||
| leucine-rich repeat | 497..543 | CDD:275380 | 15/47 (32%) | ||
| LRR 18 | 519..540 | 6/20 (30%) | |||
| LRR 19 | 543..564 | 10/20 (50%) | |||
| leucine-rich repeat | 544..566 | CDD:275380 | 10/21 (48%) | ||
| LRR 20 | 566..586 | 12/19 (63%) | |||
| leucine-rich repeat | 41..83 | CDD:275380 | |||
| LRR | 76..>346 | CDD:443914 | |||
| LRR 1 | 83..104 | ||||
| leucine-rich repeat | 84..106 | CDD:275380 | |||
| LRR 2 | 106..127 | ||||
| leucine-rich repeat | 107..129 | CDD:275380 | |||
| PLN00113 | 120..>577 | CDD:215061 | 64/176 (36%) | ||
| LRR 3 | 129..150 | ||||
| leucine-rich repeat | 130..152 | CDD:275380 | |||
| LRR 4 | 152..173 | ||||
| leucine-rich repeat | 153..175 | CDD:275380 | |||
| LRR 5 | 175..196 | ||||
| leucine-rich repeat | 176..198 | CDD:275380 | |||
| LRR 6 | 198..219 | ||||
| leucine-rich repeat | 199..221 | CDD:275380 | |||
| LRR 7 | 221..242 | ||||
| leucine-rich repeat | 222..244 | CDD:275380 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||