DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3494 and CG10307

DIOPT Version :9

Sequence 1:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001286690.1 Gene:CG10307 / 37477 FlyBaseID:FBgn0034655 Length:341 Species:Drosophila melanogaster


Alignment Length:187 Identity:56/187 - (29%)
Similarity:91/187 - (48%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPTNI 104
            |.:|..|||:|| .:.|..  |.:..:.|:.|:|.::|..:..|. .|..|.|:.|::...|..|
  Fly    28 LNLSHYQISDVP-GIIEKC--ETLMKLFLNQNKLTKIPSSIGSLM-RLQVLTLDYNKLDEFPLCI 88

  Fly   105 SQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIRAI 169
            .:..:|..|::|.|.:..||.|||.|..|.....::....:||..|...|.||||....|.::.:
  Fly    89 CRLVRLKFLNISCNNISSLPPELGYLTQLETFWCNNTGLLELPNEIRNCEHLETLGVRGNPLKKL 153

  Fly   170 -DASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSM 225
             ||    :|.:..|:.|.....::..||..:..:.|||.|.|.||..|:....:::|
  Fly   154 PDA----IGALSSLRWLTAEGCELSEVPLTMALLGNLVHLNLKGNRLRRLPRMLMAM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3494NP_611915.1 LRR <34..>231 CDD:227223 56/187 (30%)
leucine-rich repeat 38..62 CDD:275380 8/21 (38%)
leucine-rich repeat 63..86 CDD:275380 5/22 (23%)
LRR_4 85..124 CDD:289563 10/38 (26%)
leucine-rich repeat 87..109 CDD:275380 6/21 (29%)
leucine-rich repeat 110..133 CDD:275380 10/22 (45%)
leucine-rich repeat 134..155 CDD:275380 3/20 (15%)
leucine-rich repeat 156..181 CDD:275380 8/25 (32%)
leucine-rich repeat 182..204 CDD:275380 4/21 (19%)
CG10307NP_001286690.1 leucine-rich repeat 27..44 CDD:275380 7/16 (44%)
LRR_8 47..104 CDD:290566 15/57 (26%)
leucine-rich repeat 48..70 CDD:275380 5/22 (23%)
LRR 69..>244 CDD:227223 42/143 (29%)
leucine-rich repeat 71..93 CDD:275380 6/21 (29%)
leucine-rich repeat 94..116 CDD:275380 10/21 (48%)
leucine-rich repeat 117..139 CDD:275380 4/21 (19%)
leucine-rich repeat 140..162 CDD:275380 8/25 (32%)
leucine-rich repeat 163..185 CDD:275380 4/21 (19%)
leucine-rich repeat 186..208 CDD:275380 8/21 (38%)
leucine-rich repeat 209..233 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45367
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.