DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3494 and Phlpp

DIOPT Version :10

Sequence 1:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_609938.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:213 Identity:56/213 - (26%)
Similarity:94/213 - (44%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 MRNTRILQV--------SKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKD-LPLLSEHLTQ 89
            :||.||.::        ...|:.:.| |.|.:     :..:.|..|.|..:|.: ..:....|..
  Fly   176 LRNYRITELVSLDLAYNDLKQLDQFP-EGFSS-----IRSLQLQSNELPSLPDNFFAVTHARLET 234

  Fly    90 LVLNKNQISFVPT-NISQYSKLTNLSLSNNLLCDLPME-LGGLRLLRNLDISHNRFRQLP-RCIY 151
            |.::.|::|.:|. ..:.::.|.||||:.|.|.|...| |.....||.|.:::||...|| .|:.
  Fly   235 LNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVR 299

  Fly   152 ELERLETLSAHDNQIRAIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFR 216
            ....||.|....|.::.:....:.||.:|.|:..    |::.:..|.|.|:..|..|:|..|  .
  Fly   300 NWPELEILVLSGNMLQQLPEEVATLGQLRVLRCC----NNLLLCTPQLAKLAMLKVLDLSHN--H 358

  Fly   217 QPRHQILSMGTPALLSYL 234
            ..|..:|::.....|.||
  Fly   359 LDRVNLLALVPSRNLKYL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3494NP_611915.1 LRR <32..>215 CDD:443914 51/192 (27%)
leucine-rich repeat 38..62 CDD:275380 6/31 (19%)
leucine-rich repeat 63..86 CDD:275380 4/23 (17%)
leucine-rich repeat 87..109 CDD:275380 5/22 (23%)
leucine-rich repeat 110..133 CDD:275380 10/23 (43%)
leucine-rich repeat 134..155 CDD:275380 7/21 (33%)
leucine-rich repeat 156..181 CDD:275380 6/24 (25%)
leucine-rich repeat 182..204 CDD:275380 5/21 (24%)
PhlppNP_609938.1 LRR 82..>381 CDD:443914 56/213 (26%)
leucine-rich repeat 91..110 CDD:275380
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380 4/6 (67%)
leucine-rich repeat 184..209 CDD:275380 4/30 (13%)
leucine-rich repeat 210..230 CDD:275380 4/19 (21%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
leucine-rich repeat 256..276 CDD:275380 10/19 (53%)
leucine-rich repeat 280..303 CDD:275380 8/22 (36%)
leucine-rich repeat 304..348 CDD:275380 12/47 (26%)
leucine-rich repeat 349..372 CDD:275380 6/24 (25%)
PP2Cc 461..655 CDD:469621
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.