Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099051.1 | Gene: | LRRC30 / 339291 | HGNCID: | 30219 | Length: | 301 | Species: | Homo sapiens |
Alignment Length: | 228 | Identity: | 68/228 - (29%) |
---|---|---|---|
Similarity: | 108/228 - (47%) | Gaps: | 35/228 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 LQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPTNI 104
Fly 105 SQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIRAI 169
Fly 170 DASESGLGGMR--------------------ELKRLNLGNNDIQIVPPILGKMQNLVELELWG-- 212
Fly 213 --------NPFRQPRHQILSMGTPALLSYLRTR 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 65/220 (30%) |
leucine-rich repeat | 38..62 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 63..86 | CDD:275380 | 8/22 (36%) | ||
LRR_4 | 85..124 | CDD:289563 | 15/38 (39%) | ||
leucine-rich repeat | 87..109 | CDD:275380 | 7/21 (33%) | ||
leucine-rich repeat | 110..133 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 134..155 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 156..181 | CDD:275380 | 6/44 (14%) | ||
leucine-rich repeat | 182..204 | CDD:275380 | 11/21 (52%) | ||
LRRC30 | NP_001099051.1 | LRR 1 | 72..93 | 6/16 (38%) | |
leucine-rich repeat | 73..95 | CDD:275380 | 6/18 (33%) | ||
LRR_8 | 94..173 | CDD:290566 | 30/82 (37%) | ||
LRR 2 | 95..116 | 6/23 (26%) | |||
leucine-rich repeat | 96..118 | CDD:275380 | 8/22 (36%) | ||
LRR 3 | 118..139 | 7/20 (35%) | |||
leucine-rich repeat | 119..141 | CDD:275380 | 7/21 (33%) | ||
LRR_4 | 141..179 | CDD:289563 | 17/37 (46%) | ||
LRR 4 | 141..163 | 10/21 (48%) | |||
leucine-rich repeat | 142..164 | CDD:275380 | 10/21 (48%) | ||
LRR 5 | 164..185 | 8/20 (40%) | |||
leucine-rich repeat | 165..187 | CDD:275380 | 9/21 (43%) | ||
LRR 6 | 187..208 | 5/20 (25%) | |||
leucine-rich repeat | 188..210 | CDD:275380 | 6/21 (29%) | ||
LRR 7 | 210..231 | 0/20 (0%) | |||
leucine-rich repeat | 211..229 | CDD:275380 | 0/17 (0%) | ||
LRR 8 | 233..254 | 11/20 (55%) | |||
leucine-rich repeat | 257..277 | CDD:275378 | 5/20 (25%) | ||
LRR 9 | 265..287 | 3/21 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154188 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |