| Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956156.2 | Gene: | lrrc40 / 334130 | ZFINID: | ZDB-GENE-030131-6062 | Length: | 601 | Species: | Danio rerio |
| Alignment Length: | 209 | Identity: | 81/209 - (38%) |
|---|---|---|---|
| Similarity: | 117/209 - (55%) | Gaps: | 8/209 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 MRNTRILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQIS 98
Fly 99 FVPTNISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHD 163
Fly 164 NQIRAIDASESGLGGMRELKR---LNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSM 225
Fly 226 GTPALLSYLRTRIP 239 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 74/199 (37%) |
| leucine-rich repeat | 38..62 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 63..86 | CDD:275380 | 6/22 (27%) | ||
| LRR_4 | 85..124 | CDD:289563 | 10/38 (26%) | ||
| leucine-rich repeat | 87..109 | CDD:275380 | 4/21 (19%) | ||
| leucine-rich repeat | 110..133 | CDD:275380 | 13/22 (59%) | ||
| leucine-rich repeat | 134..155 | CDD:275380 | 7/20 (35%) | ||
| leucine-rich repeat | 156..181 | CDD:275380 | 9/24 (38%) | ||
| leucine-rich repeat | 182..204 | CDD:275380 | 13/24 (54%) | ||
| lrrc40 | NP_956156.2 | LRR 1 | 33..56 | ||
| LRR 2 | 79..101 | ||||
| LRR_8 | 82..138 | CDD:290566 | |||
| leucine-rich repeat | 82..104 | CDD:275380 | |||
| LRR_RI | 99..343 | CDD:238064 | |||
| LRR 3 | 102..124 | ||||
| leucine-rich repeat | 105..127 | CDD:275380 | |||
| LRR 4 | 125..148 | ||||
| LRR_8 | 127..184 | CDD:290566 | |||
| leucine-rich repeat | 128..150 | CDD:275380 | |||
| LRR 5 | 150..170 | ||||
| leucine-rich repeat | 151..173 | CDD:275380 | |||
| LRR 6 | 171..193 | ||||
| leucine-rich repeat | 174..196 | CDD:275380 | |||
| LRR 7 | 194..217 | ||||
| LRR_8 | 196..253 | CDD:290566 | |||
| leucine-rich repeat | 197..219 | CDD:275380 | |||
| LRR 8 | 219..239 | ||||
| leucine-rich repeat | 220..242 | CDD:275380 | |||
| LRR 9 | 240..264 | ||||
| leucine-rich repeat | 243..288 | CDD:275380 | |||
| LRR_8 | 263..322 | CDD:290566 | |||
| LRR 10 | 266..285 | ||||
| LRR 11 | 286..308 | ||||
| leucine-rich repeat | 289..311 | CDD:275380 | |||
| LRR 12 | 309..334 | ||||
| leucine-rich repeat | 335..354 | CDD:275380 | |||
| LRR 13 | 336..355 | ||||
| LRR 14 | 397..420 | 5/22 (23%) | |||
| leucine-rich repeat | 400..449 | CDD:275380 | 12/48 (25%) | ||
| LRR 15 | 423..446 | 5/22 (23%) | |||
| LRR 16 | 447..469 | 4/21 (19%) | |||
| LRR_8 | 449..506 | CDD:290566 | 21/56 (38%) | ||
| leucine-rich repeat | 450..472 | CDD:275380 | 4/21 (19%) | ||
| LRR 17 | 470..492 | 11/21 (52%) | |||
| leucine-rich repeat | 473..495 | CDD:275380 | 13/21 (62%) | ||
| LRR 18 | 493..516 | 9/22 (41%) | |||
| leucine-rich repeat | 496..518 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 517..576 | CDD:290566 | 27/63 (43%) | ||
| LRR 19 | 518..539 | 9/25 (36%) | |||
| leucine-rich repeat | 519..542 | CDD:275380 | 10/27 (37%) | ||
| LRR 20 | 540..563 | 13/22 (59%) | |||
| leucine-rich repeat | 543..565 | CDD:275380 | 11/21 (52%) | ||
| LRR 21 | 565..586 | 12/20 (60%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0472 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D295141at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0005608 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.820 | |||||