DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3494 and Lrrc10

DIOPT Version :9

Sequence 1:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001101566.1 Gene:Lrrc10 / 314848 RGDID:1307358 Length:273 Species:Rattus norvegicus


Alignment Length:187 Identity:61/187 - (32%)
Similarity:91/187 - (48%) Gaps:7/187 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DKYHMRNTRILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNK 94
            |...|...|::.:|.:|:...|:.|  .:..|||.:. |..|.|..:|.||..| ::|..|.|:.
  Rat    24 DLREMPLDRMVDLSGSQLRRFPLHV--CSFTELVKLY-LSDNHLHSLPPDLAQL-QNLQILALDF 84

  Fly    95 NQISFVPTNISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETL 159
            |....:|..:....:|..|.|.||.|||||.||..|:.||.|.:..|...:||..:.||..|:||
  Rat    85 NNFKALPQAVCTLKQLCILYLGNNKLCDLPDELSLLQNLRTLWLESNCLTRLPDVVCELSLLKTL 149

  Fly   160 SAHDNQIRAIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFR 216
            .|..|.:|.:...   |..:|||:.:.|..|.:...|.:|..|..|..:::..|..|
  Rat   150 HAGSNALRLLPGQ---LRRLRELRTIWLSGNQLADFPSVLLHMPFLEVIDVDRNSIR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3494NP_611915.1 LRR <34..>231 CDD:227223 60/183 (33%)
leucine-rich repeat 38..62 CDD:275380 5/23 (22%)
leucine-rich repeat 63..86 CDD:275380 8/22 (36%)
LRR_4 85..124 CDD:289563 13/38 (34%)
leucine-rich repeat 87..109 CDD:275380 5/21 (24%)
leucine-rich repeat 110..133 CDD:275380 13/22 (59%)
leucine-rich repeat 134..155 CDD:275380 7/20 (35%)
leucine-rich repeat 156..181 CDD:275380 7/24 (29%)
leucine-rich repeat 182..204 CDD:275380 6/21 (29%)
Lrrc10NP_001101566.1 leucine-rich repeat 32..53 CDD:275380 5/22 (23%)
LRR_8 52..110 CDD:290566 20/59 (34%)
leucine-rich repeat 54..76 CDD:275380 9/23 (39%)
leucine-rich repeat 77..99 CDD:275380 5/21 (24%)
LRR_RI <88..200 CDD:238064 38/114 (33%)
leucine-rich repeat 100..122 CDD:275380 13/21 (62%)
leucine-rich repeat 123..145 CDD:275380 8/21 (38%)
leucine-rich repeat 146..168 CDD:275380 7/24 (29%)
leucine-rich repeat 169..191 CDD:275380 6/21 (29%)
leucine-rich repeat 192..213 CDD:275380 3/12 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.