DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3494 and Lrrc40

DIOPT Version :9

Sequence 1:NP_611915.1 Gene:CG3494 / 37903 FlyBaseID:FBgn0035008 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006233600.1 Gene:Lrrc40 / 310946 RGDID:1562017 Length:602 Species:Rattus norvegicus


Alignment Length:202 Identity:75/202 - (37%)
Similarity:114/202 - (56%) Gaps:2/202 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RILQVSKAQISEVPMEVFEAAQQELVNIVSLDGNRLLEMPKDLPLLSEHLTQLVLNKNQISFVPT 102
            ::|..|..|.:.:|.::|:|.:..:|..::...|:|.|:|:.:..|.|.:..:.|:.|::|.|..
  Rat   402 KLLDYSDKQATLIPDDIFDATKNTVVTSINFSKNQLCEIPQRIAELKEMVLDVNLSFNKLSLVSH 466

  Fly   103 NISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQIR 167
            .:....||..|.|.||.|..||.|:..|..|:.:::|.|||:..|..:|.:..|||:...:||:.
  Rat   467 ELCLLQKLAFLDLRNNFLSSLPEEMSSLTKLQTINLSFNRFKVFPAVLYHISTLETILISNNQVG 531

  Fly   168 AIDASESGLGGMRELKRLNLGNNDIQIVPPILGKMQNLVELELWGNPFRQPRHQILSMGTPALLS 232
            ::|..:..|  |..|..|:|.|||:..:||.||....|..|.|.|||||.||..||..||.|:|.
  Rat   532 SVDPLKMKL--MENLSTLDLQNNDLLQIPPELGNCVQLRTLLLDGNPFRVPRAAILMKGTAAVLE 594

  Fly   233 YLRTRIP 239
            |||.|||
  Rat   595 YLRDRIP 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3494NP_611915.1 LRR <34..>231 CDD:227223 68/192 (35%)
leucine-rich repeat 38..62 CDD:275380 6/23 (26%)
leucine-rich repeat 63..86 CDD:275380 6/22 (27%)
LRR_4 85..124 CDD:289563 12/38 (32%)
leucine-rich repeat 87..109 CDD:275380 4/21 (19%)
leucine-rich repeat 110..133 CDD:275380 10/22 (45%)
leucine-rich repeat 134..155 CDD:275380 6/20 (30%)
leucine-rich repeat 156..181 CDD:275380 8/24 (33%)
leucine-rich repeat 182..204 CDD:275380 10/21 (48%)
Lrrc40XP_006233600.1 leucine-rich repeat 84..106 CDD:275380
PLN00113 89..>577 CDD:215061 58/176 (33%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 130..152 CDD:275380
leucine-rich repeat 153..175 CDD:275380
leucine-rich repeat 176..221 CDD:275380
leucine-rich repeat 222..244 CDD:275380
leucine-rich repeat 245..266 CDD:275380
leucine-rich repeat 267..290 CDD:275380
leucine-rich repeat 291..313 CDD:275380
leucine-rich repeat 427..473 CDD:275380 11/45 (24%)
leucine-rich repeat 474..496 CDD:275380 10/21 (48%)
leucine-rich repeat 497..519 CDD:275380 7/21 (33%)
leucine-rich repeat 520..543 CDD:275380 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0472
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D295141at33208
OrthoFinder 1 1.000 - - FOG0005608
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.