Sequence 1: | NP_611915.1 | Gene: | CG3494 / 37903 | FlyBaseID: | FBgn0035008 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028512.2 | Gene: | Lrrc30 / 240131 | MGIID: | 2685172 | Length: | 300 | Species: | Mus musculus |
Alignment Length: | 231 | Identity: | 68/231 - (29%) |
---|---|---|---|
Similarity: | 105/231 - (45%) | Gaps: | 34/231 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 ILQVSKAQISEVPMEVFEAAQQELVNIVSLD--GNRLLEMPKDLPLLSEHLTQLVLNKNQISFVP 101
Fly 102 TNISQYSKLTNLSLSNNLLCDLPMELGGLRLLRNLDISHNRFRQLPRCIYELERLETLSAHDNQI 166
Fly 167 RAIDASESGLGGMR--------------------ELKRLNLGNNDIQIVPPILGKMQNLVELELW 211
Fly 212 G----------NPFRQPRHQILSMGTPALLSYLRTR 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3494 | NP_611915.1 | LRR | <34..>231 | CDD:227223 | 64/223 (29%) |
leucine-rich repeat | 38..62 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 63..86 | CDD:275380 | 9/24 (38%) | ||
LRR_4 | 85..124 | CDD:289563 | 14/38 (37%) | ||
leucine-rich repeat | 87..109 | CDD:275380 | 8/21 (38%) | ||
leucine-rich repeat | 110..133 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 134..155 | CDD:275380 | 8/20 (40%) | ||
leucine-rich repeat | 156..181 | CDD:275380 | 6/44 (14%) | ||
leucine-rich repeat | 182..204 | CDD:275380 | 11/21 (52%) | ||
Lrrc30 | NP_001028512.2 | LRR 1 | 47..69 | 68/231 (29%) | |
LRR 2 | 70..92 | 5/21 (24%) | |||
leucine-rich repeat | 72..94 | CDD:275380 | 5/21 (24%) | ||
LRR 3 | 94..115 | 7/20 (35%) | |||
leucine-rich repeat | 95..117 | CDD:275380 | 9/22 (41%) | ||
LRR 4 | 116..138 | 8/21 (38%) | |||
LRR_8 | 117..174 | CDD:290566 | 22/56 (39%) | ||
leucine-rich repeat | 118..140 | CDD:275380 | 8/21 (38%) | ||
LRR 5 | 139..161 | 8/21 (38%) | |||
LRR_4 | 140..178 | CDD:289563 | 15/37 (41%) | ||
leucine-rich repeat | 141..163 | CDD:275380 | 9/21 (43%) | ||
LRR 6 | 162..184 | 8/21 (38%) | |||
leucine-rich repeat | 164..186 | CDD:275380 | 9/21 (43%) | ||
LRR 7 | 186..207 | 5/20 (25%) | |||
leucine-rich repeat | 187..209 | CDD:275380 | 6/21 (29%) | ||
LRR 8 | 209..230 | 0/20 (0%) | |||
leucine-rich repeat | 210..228 | CDD:275380 | 0/17 (0%) | ||
LRR 9 | 231..253 | 11/21 (52%) | |||
LRR 10 | 261..286 | 4/24 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844430 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |