DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ppiA

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_417822.1 Gene:ppiA / 947870 ECOCYCID:EG10757 Length:190 Species:Escherichia coli


Alignment Length:142 Identity:33/142 - (23%)
Similarity:54/142 - (38%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQRSTELTNIEHDFEV 325
            |.:.::|..:..|..|..|:........:...|:|.:....::|      ...||....:.....
E. coli    38 GNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQG------GGFTEQMQQKKPNPP 96

  Fly   326 LNHGVDAGILSFPSRYVRGN---ARTA------VNFTISFKPLSIL-NGRR----IAFGKVRKGM 376
            :.:..|.|:     |..||.   ||||      ..|.|:....:.| :|:|    ..||||.|||
E. coli    97 IKNEADNGL-----RNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGM 156

  Fly   377 QLLERIQVAVGH 388
            .:.::|.....|
E. coli   157 DVADKISQVPTH 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 32/140 (23%)
ppiANP_417822.1 PRK10903 1..190 CDD:182824 33/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.