DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CPR3

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_013633.1 Gene:CPR3 / 854897 SGDID:S000004543 Length:182 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:40/158 - (25%)
Similarity:67/158 - (42%) Gaps:34/158 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEGR 305
            |..:::.|..|...:| ||:..:|:....|:....|..:||....   ..:.|:|.:....::| 
Yeast    20 LGKKVFFDPAVNGTKI-GRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQG- 82

  Fly   306 LAMDPQRSTELTN------------IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTIS 355
                  ..|:|||            .:.:| |..|. .||:||.      .||....|   |.|:
Yeast    83 ------GDTDLTNGFGGKSIYGSKFADENF-VKKHD-KAGLLSM------ANAGPNTNGSQFFIT 133

  Fly   356 FKPLSILNGRRIAFGKVRKGMQLLERIQ 383
            ..|...|:|:.:.||:|.|||.:::.|:
Yeast   134 TVPCPWLDGKHVVFGEVTKGMDIVKAIE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 39/153 (25%)
CPR3NP_013633.1 cyclophilin_ABH_like 23..180 CDD:238907 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.