DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CPR7

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_012566.1 Gene:CPR7 / 853489 SGDID:S000003793 Length:393 Species:Saccharomyces cerevisiae


Alignment Length:195 Identity:43/195 - (22%)
Similarity:79/195 - (40%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIV-----------FNRALAP 299
            |.:||||.:.:..| ||::.:||.|..|:....|.::|..:..|.:.           |:|.:..
Yeast     5 PLVYLDISIDKKPI-GRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLSYKGNGFHRVVKN 68

  Fly   300 IWME-GRLAMDPQRSTELTN--------------IEHDFEVLNHG--VDAGILSFPSRYVRGNAR 347
            ..:: |.:....|:.:..::              ::.|.|...:|  .|..:..|...:..|.|.
Yeast    69 FMIQAGDIVFGTQKDSSSSSVGKGGCSIYADKEEVKTDDESFCYGNFEDENLGEFVEPFTLGMAN 133

  Fly   348 TA------VNFTISFKPLSILNGRRIAFGKVRKG---MQLLERIQVAVGHLPMSHNLISLTDCGV 403
            ..      ..|.|:......|||:...||:|..|   ::.:|..:|....:|.|.  :.::||||
Yeast   134 LGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGKSVVRTIENCRVDSDGVPESD--VRISDCGV 196

  Fly   404  403
            Yeast   197  196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/175 (21%)
CPR7NP_012566.1 cyclophilin 5..195 CDD:412213 40/192 (21%)
TPR <233..383 CDD:223533
TPR repeat 274..321 CDD:276809
TPR_16 296..353 CDD:404335
TPR_1 330..363 CDD:395414
TPR repeat 330..353 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.