DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CPR5

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_010590.3 Gene:CPR5 / 851898 SGDID:S000002712 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:165 Identity:38/165 - (23%)
Similarity:73/165 - (44%) Gaps:24/165 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 QIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQN-------NSSAIVFNRALAPIWMEG 304
            ::|.||...:.:| ||:::.|:....||.|..|.::....       ||   :|:|.:....::|
Yeast    35 KVYFDINHGDKQI-GRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNS---IFHRVIPNFMIQG 95

  Fly   305 -----RLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNG 364
                 |..:..:.....|..:.:|:|.:.  ..|.||..:   ||.......|.|:..|...|:|
Yeast    96 GDFTHRSGIGGKSIFGNTFKDENFDVKHD--KPGRLSMAN---RGKNTNGSQFFITTVPCPWLDG 155

  Fly   365 RRIAFGKVRKGMQL---LERIQVAVGHLPMSHNLI 396
            :.:.||:|..||.:   :|.::....::|:...:|
Yeast   156 KHVVFGEVLDGMDVVHYIENVKTDSRNMPVKEVII 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/153 (24%)
CPR5NP_010590.3 cyclophilin 34..194 CDD:412213 38/165 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.