DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CPR6

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_013317.1 Gene:CPR6 / 850914 SGDID:S000004206 Length:371 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:41/189 - (21%)
Similarity:78/189 - (41%) Gaps:41/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSA------------IVFNR 295
            :.||:.:.||.: ..:.|||::.:|:.:..|:....|:::|..|...|            .:|:|
Yeast     1 MTRPKTFFDISI-GGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHR 64

  Fly   296 ALAPIWME-----------GRLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTA 349
            .:.....:           |....|.:...|...::||...|....:||          .|...:
Yeast    65 VIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAG----------PNTNGS 119

  Fly   350 VNFTISFKPLSILNGRRIAFGKVRKG---MQLLERIQV-AVGHLPMSHNLISLTDCGVI 404
            ..| |:..|...|:|:.:.||:|.:|   ::|:|..|. ...:.|:..  :.:.||||:
Yeast   120 QAF-ITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRD--VKIDDCGVL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/165 (21%)
CPR6NP_013317.1 cyclophilin_ABH_like 4..173 CDD:238907 37/182 (20%)
TPR repeat 219..264 CDD:276809
TPR repeat 269..303 CDD:276809
TPR repeat 308..334 CDD:276809
TPR_1 311..341 CDD:395414
TPR repeat 342..368 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.