DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CPR4

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_009995.1 Gene:CPR4 / 850433 SGDID:S000000665 Length:318 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:44/241 - (18%)
Similarity:78/241 - (32%) Gaps:115/241 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 PEAGK---------SKRYKPKSSGSFSCEIPMHVLHRYENLMDQCDVGVLCKLLRPQIYLDIEVR 255
            |.:||         .|:|:|....:          ||          |::     ...|.| .|.
Yeast    22 PSSGKQITSKDVDLQKKYEPSPPAT----------HR----------GII-----TIEYFD-PVS 60

  Fly   256 EARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQ-------RS 313
            ::..:..|..:|:....|:.|          |:.|::.:...|.|  ||:   ||.       |.
Yeast    61 KSMKEADLTFELYGTVVPKTV----------NNFAMLAHGVKAVI--EGK---DPNDIHTYSYRK 110

  Fly   314 TELTNIEHDFEVLNHGVDAGILSFPSRYVRGN--ARTAVNFTI---------------------- 354
            |::..:                 :|::|::|.  |.....||:                      
Yeast   111 TKINKV-----------------YPNKYIQGGVVAPDVGPFTVYGPKFDDENFYLKHDRPERLAM 158

  Fly   355 -SFKPLS---------------ILNGRRIAFGKVRKGM-QLLERIQ 383
             .|.|.|               .|:|:.:.||::..|: ||::.||
Yeast   159 AYFGPDSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLMDAIQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 35/183 (19%)
CPR4NP_009995.1 cyclophilin 67..219 CDD:238194 32/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.