DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and PUB49

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_201554.1 Gene:PUB49 / 836889 AraportID:AT5G67530 Length:595 Species:Arabidopsis thaliana


Alignment Length:414 Identity:74/414 - (17%)
Similarity:139/414 - (33%) Gaps:112/414 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 PYTMTNPVYNTHNPNLVGLDGQ--VEDSRPKHTFNVKRQELENNYRHHQRLIPVPTSRRTMPKIR 95
            |:|..: :....|||.|  ||:  ||....|:...:..:||:                    |:.
plant   149 PFTRAD-LITIQNPNAV--DGKVTVEFDHVKNGLKIDDEELK--------------------KMN 190

  Fly    96 SHIVMNEQRELYRQHRDRMSNIKGKVNTYL------PPPKVQIEGNGMELSYMEMLTAL------ 148
            |....|             .|:.|.:...|      ...::.:.|.|...:..|...|:      
plant   191 SDPAYN-------------INVSGDIKHMLADLGTDKAKEIALHGGGGNKARNERAAAIAAILES 242

  Fly   149 ------YKKSNNTLRTFTKSPERLAAGRWRNANLAREKERRQLEKNKEFHKGGELFDPEAGKSKR 207
                  ..|:....:|::......|:...|:|:.|:.....:.......|..|   |.....||.
plant   243 RSKIKEVSKAEQPKQTYSVVDAASASVFGRSADAAKAGSSDKTAARIAMHMAG---DRTPVNSKM 304

  Fly   208 YKPK-SSGSFSCEIPMHVLHRYENLMDQCDVGVLCKLLRPQIYLDIEV--------REARIQ--- 260
            .|.: |||:.|...                   ......|....|.|:        ::..:|   
plant   305 VKSRYSSGAASRSF-------------------TSSAFTPVTKNDFELIKVEKNPKKKGYVQFQT 350

  Fly   261 --GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQRS--------TE 315
              |.|.|:|..:..|:....|:.:|.:...:.:.|:|::....::|.   ||..:        .:
plant   351 THGDLNIELHCDIAPRACENFITLCERGYYNGVAFHRSIRNFMIQGG---DPTGTGKGGESIWGK 412

  Fly   316 LTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLE 380
            ....|.:.::|:.|  .|::|..:   .|.......|.:.:|..:.||.:...||.|..|:..| 
plant   413 PFKDEPNSKLLHSG--RGVVSMAN---SGPHTNGSQFFVLYKSATHLNYKHTVFGGVVGGLATL- 471

  Fly   381 RIQVAVGHLPMSHNLISLTDCGVI 404
               .|:.::|:..:...|.:..:|
plant   472 ---AAMENVPVDESDRPLEEIKII 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/159 (19%)
PUB49NP_201554.1 RING 39..101 CDD:302633
cyclophilin_RING 345..502 CDD:238904 32/160 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.