DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ROC7

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_200679.1 Gene:ROC7 / 835985 AraportID:AT5G58710 Length:204 Species:Arabidopsis thaliana


Alignment Length:202 Identity:44/202 - (21%)
Similarity:79/202 - (39%) Gaps:64/202 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ENLMDQCDVGVLCKLLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICT-----QNNS 288
            |||          |.:..::|.|:|: :.:..||:::.||.:..|:.|..|..:||     ..|.
plant    28 ENL----------KEITHKVYFDVEI-DGKAAGRIVMGLFGKTVPKTVENFRALCTGEKGIGKNG 81

  Fly   289 SAI-----VFNRALAPIWMEGRLAMDPQRSTELTN--------------IEHDFEVLNHGVDAGI 334
            .|:     .|:|.:....::|         .:.|:              .:.:|::.:.|  .|.
plant    82 KALHYKGSSFHRIIPSFMLQG---------GDFTHGNGMGGESIYGEKFADENFKLKHTG--PGF 135

  Fly   335 LSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQ---------------V 384
            ||..:   .|.......|.|:....|.|:||.:.||||..||.::.:::               |
plant   136 LSMAN---AGQDTNGSQFFITTVTTSWLDGRHVVFGKVVTGMDVVYKVEAEGNQSGTPKSKVVIV 197

  Fly   385 AVGHLPM 391
            ..|.||:
plant   198 DSGELPL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 37/177 (21%)
ROC7NP_200679.1 cyclophilin_ABH_like 35..200 CDD:238907 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.