DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AT4G33060

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_195032.2 Gene:AT4G33060 / 829443 AraportID:AT4G33060 Length:504 Species:Arabidopsis thaliana


Alignment Length:247 Identity:45/247 - (18%)
Similarity:89/247 - (36%) Gaps:74/247 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AAVKRGPYTMTNPVYNTHNPNLVGLDGQVE---DSRPKHTFNVKRQELENNYRHHQRLIPVPTSR 88
            ||.|...:::::.|.|:.:.:    ||:.|   |::.::....:|:|:.:....       ||.:
plant   269 AAQKDKSFSVSDTVGNSDDDD----DGEDETKFDAKMRNQVLSRRKEIGDTPSK-------PTQK 322

  Fly    89 RTMPKI--------RSHIVMNEQR----------------ELYRQHRDR------MSNIKGKVNT 123
            :....:        ||..|.:|..                |...:|.::      :.|...:...
plant   323 KKSSSLKGREESTQRSDAVSSEDEKPRMEKLSLKKKGIGSEAKAEHMEKGDTDLQLYNASERARQ 387

  Fly   124 YLPPPKVQIEGNGMELSYMEMLTALYKKSNNTLRTFTKSPERLA--------------AGRWRNA 174
            .....|.:::||  |.|.:..|...  |.:.:.:.||.|.|.:.              ...|:|.
plant   388 LHKLKKRRLQGN--EDSVLAKLEKF--KQSISAKPFTSSNEPVVLTSSSEPVDNKEEDLSDWKNV 448

  Fly   175 NL--AREKERRQLEKNKE----------FHKGGELFDPEAGKSKRYKPKSSG 214
            .|  |.|:.:.::.:..:          ..||.|.|:....|.||.:.:.||
plant   449 KLKFAPERGKDKMSRRDDPDAYMVVDPLLEKGKEKFNRMQAKQKRREREWSG 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131
AT4G33060NP_195032.2 cyclophilin_CeCYP16-like 8..180 CDD:238906
PTZ00121 <248..>497 CDD:173412 43/242 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.