DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ROC2

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001319764.1 Gene:ROC2 / 824773 AraportID:AT3G56070 Length:176 Species:Arabidopsis thaliana


Alignment Length:177 Identity:39/177 - (22%)
Similarity:71/177 - (40%) Gaps:25/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS----------SAIVFNRAL 297
            :..|:::.||.:.:.: .||::::||.:..|:....|..:||..|.          ....|:|.:
plant     1 MANPKVFFDILIGKMK-AGRVVMELFADVTPRTANNFRALCTGENGIGKAGKALHYKGSAFHRII 64

  Fly   298 APIWMEGRLAMDPQR-------STELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTIS 355
            .....:|.   |..|       |...:..|.:...|.| ...||||..:   .|.......|.|.
plant    65 PGFMCQGG---DFTRGNGTGGESIYGSKFEDENFKLKH-TGPGILSMAN---SGPNTNGSQFFIC 122

  Fly   356 FKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCG 402
            .:..|.|:|:.:.||||..|..:::.::.....:......:.:.|||
plant   123 TEKTSWLDGKHVVFGKVVDGYNVVKAMEDVGSDMGNPSERVVIEDCG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 35/155 (23%)
ROC2NP_001319764.1 cyclophilin_ABH_like 4..169 CDD:238907 37/172 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.