DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AT3G55920

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_567029.1 Gene:AT3G55920 / 824758 AraportID:AT3G55920 Length:228 Species:Arabidopsis thaliana


Alignment Length:152 Identity:35/152 - (23%)
Similarity:62/152 - (40%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 QIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS----------SAIVFNRALAPIW 301
            ::|.||::..:. .||::|.||....|:....|..:||....          ....|:|.:....
plant    60 KVYFDIQINGSP-AGRILIGLFGNIVPKTAENFRSLCTGEKGVGNMGKPLYFKGSSFHRIIPGFM 123

  Fly   302 ME-GRLAMDPQRSTELTN----IEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSI 361
            :: |.......|..|...    .:.:|::.:.|  .|.||..:   .|.......|.|:....|.
plant   124 IQGGDFTRGDGRGGESIYGDKFADENFKLKHTG--PGFLSMAN---SGPDSNGSQFFITTVTTSW 183

  Fly   362 LNGRRIAFGKVRKGMQLLERIQ 383
            |:|..:.||||..||:::.:|:
plant   184 LDGHHVVFGKVLSGMEVVRKIE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 35/150 (23%)
AT3G55920NP_567029.1 cyclophilin_ABH_like 59..224 CDD:238907 35/152 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.