DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and SQN

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_565381.1 Gene:SQN / 816074 AraportID:AT2G15790 Length:361 Species:Arabidopsis thaliana


Alignment Length:177 Identity:43/177 - (24%)
Similarity:79/177 - (44%) Gaps:23/177 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQN-----NSSAIV------FNRALA 298
            |.:.::||.: ...::||::|:|:.:..|:....|..:||..     |:...:      |:|.:.
plant     3 RSKCFMDISI-GGELEGRIVIELYDDVVPKTAENFRLLCTGEKGLGPNTGVPLHYKGNRFHRVIK 66

  Fly   299 PIWMEGR--LAMDPQRSTELTNIEHD---FEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKP 358
            ...::|.  .|.|......:..::.|   || |.| ...|:||..:   .|.......|.|:...
plant    67 GFMIQGGDISANDGTGGESIYGLKFDDENFE-LKH-ERKGMLSMAN---SGPNTNGSQFFITTTR 126

  Fly   359 LSILNGRRIAFGKVRKGMQLLERIQ-VAVGHLPMSHNLISLTDCGVI 404
            .|.|:|:.:.||:|.|||.::..|: |::.........:.:.|||.|
plant   127 TSHLDGKHVVFGRVTKGMGVVRSIEHVSIEEQSCPSQDVVIHDCGEI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 38/155 (25%)
SQNNP_565381.1 cyclophilin_ABH_like 4..171 CDD:238907 39/172 (23%)
TPR_11 216..329 CDD:290150
TPR repeat 263..293 CDD:276809
TPR_2 298..331 CDD:285020
TPR repeat 298..326 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.