DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and crot

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001128278.1 Gene:crot / 733879 XenbaseID:XB-GENE-988067 Length:481 Species:Xenopus tropicalis


Alignment Length:135 Identity:30/135 - (22%)
Similarity:53/135 - (39%) Gaps:46/135 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 SKRYKPKSSGSFSCEIPMHVLHRYENLMDQCDVGVLCKLLRPQIYLDIEVREARIQGRLIIQLFT 269
            |.|:|.:|.|  ||  |.|                |..:.|.:|:....|.|.        |:.|
 Frog   177 SSRFKTESEG--SC--PTH----------------LAVMARGRIFTFDAVPEG--------QILT 213

  Fly   270 EACPQVV--LEFMRICTQNNSSAIVFNRALAPIWMEGR----------LAMDPQRSTELTNIEHD 322
            .  |:::  |::::...|...:.|    .|:.:..|.|          :::||..||.|.:|:..
 Frog   214 P--PELLRQLQYIQDICQTEPAGI----GLSALTTEERTRWAQIREHLISLDPMNSTHLEDIQSS 272

  Fly   323 FEVLN 327
            ..:|:
 Frog   273 LFILS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 18/91 (20%)
crotNP_001128278.1 Carn_acyltransf 20..>475 CDD:279140 30/135 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.