DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Ppil3

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_011236892.1 Gene:Ppil3 / 70225 MGIID:1917475 Length:176 Species:Mus musculus


Alignment Length:151 Identity:35/151 - (23%)
Similarity:61/151 - (40%) Gaps:26/151 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWMEGRLAMDPQ------RSTELTNI 319
            |.:.|::|.|..|:....|:.:|..|..:..||:|.:....::   ..||.      .|......
Mouse    10 GDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQ---TGDPTGTGRGGSSIWAKKF 71

  Fly   320 EHDF-EVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQ 383
            |.:: |.|.|.| .|::|..:   .|.......|.|::.....|:.:...|||:.:.    ..:|
Mouse    72 EDEYSEYLKHNV-RGVVSMAN---NGPNTNGSQFFITYGKQPHLDMKYTVFGKLLRP----TIVQ 128

  Fly   384 VAVGHLPMSHNLISLTDCGVI 404
            |:|      |:  .|..|.|:
Mouse   129 VSV------HD--DLFQCFVV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 31/133 (23%)
Ppil3XP_011236892.1 Cyclophilin_PPIL3_like 1..>122 CDD:238909 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.