DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and PPIAL4A

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001137355.1 Gene:PPIAL4A / 653505 HGNCID:24369 Length:164 Species:Homo sapiens


Alignment Length:165 Identity:37/165 - (22%)
Similarity:67/165 - (40%) Gaps:18/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEG----R 305
            ::.||.| :.:..||:.|:||.:...:....|..:.|....   ....|:|.:.....:|    |
Human     6 VFFDITV-DGKPLGRISIKLFADKILKTAENFRALSTGEKGFRYKGSCFHRIIPGFMCQGGDFTR 69

  Fly   306 LAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTISFKPLSILNGRRI 367
            ......:|......:.:..:..| ..:||||.      .||....|   |.|.......|:|:.:
Human    70 HNGTGDKSIYGEKFDDENLIRKH-TGSGILSM------ANAGPNTNGSQFFICAAKTEWLDGKHV 127

  Fly   368 AFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCG 402
            |||||::.:.::|.::........:...|::.|||
Human   128 AFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 33/148 (22%)
PPIAL4ANP_001137355.1 cyclophilin 4..162 CDD:294131 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.