powered by:
Protein Alignment CG3492 and ZC250.5
DIOPT Version :9
Sequence 1: | NP_611914.1 |
Gene: | CG3492 / 37902 |
FlyBaseID: | FBgn0035007 |
Length: | 404 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001123073.1 |
Gene: | ZC250.5 / 6418817 |
WormBaseID: | WBGene00045306 |
Length: | 204 |
Species: | Caenorhabditis elegans |
Alignment Length: | 32 |
Identity: | 12/32 - (37%) |
Similarity: | 15/32 - (46%) |
Gaps: | 7/32 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 QASRGKIPQIPSSMTP-------YVAAVKRGP 33
|.:|||:..:||...| ||...|.||
Worm 129 QNTRGKVILLPSDTNPTVFSSLFYVLLDKSGP 160
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3492 | NP_611914.1 |
cyclophilin |
249..388 |
CDD:294131 |
|
ZC250.5 | NP_001123073.1 |
cyclophilin |
44..200 |
CDD:381853 |
12/32 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0652 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.