DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and PPIB

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_000933.1 Gene:PPIB / 5479 HGNCID:9255 Length:216 Species:Homo sapiens


Alignment Length:178 Identity:42/178 - (23%)
Similarity:79/178 - (44%) Gaps:37/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 QIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICT------QNNSSAIVFNRALAPIWMEGR 305
            ::|.|:.:.:..: ||:|..||.:..|:.|..|:.:.|      ..||.   |:|.:....::|.
Human    45 KVYFDLRIGDEDV-GRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSK---FHRVIKDFMIQGG 105

  Fly   306 LAMDPQR--STELTNI------EHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTISFKPL 359
               |..|  .|...:|      :.:|::.::|        |......||....|   |.|:....
Human   106 ---DFTRGDGTGGKSIYGERFPDENFKLKHYG--------PGWVSMANAGKDTNGSQFFITTVKT 159

  Fly   360 SILNGRRIAFGKVRKGMQLLERIQ---VAVGHLPMSHNLISLTDCGVI 404
            :.|:|:.:.||||.:||:::.:::   ......|:...:|:  |||.|
Human   160 AWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIA--DCGKI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/158 (23%)
PPIBNP_000933.1 cyclophilin_ABH_like 45..203 CDD:238907 39/174 (22%)
Prevents secretion from ER 213..216
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.