DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and PPIA

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_066953.1 Gene:PPIA / 5478 HGNCID:9253 Length:165 Species:Homo sapiens


Alignment Length:170 Identity:41/170 - (24%)
Similarity:69/170 - (40%) Gaps:18/170 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEG 304
            ::.|.::.||.| :....||:..:||.:..|:....|..:.|....   ....|:|.:.....:|
Human     1 MVNPTVFFDIAV-DGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQG 64

  Fly   305 ----RLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVN---FTISFKPLSIL 362
                |......:|......|.:..:|.| ...||||.      .||....|   |.|.......|
Human    65 GDFTRHNGTGGKSIYGEKFEDENFILKH-TGPGILSM------ANAGPNTNGSQFFICTAKTEWL 122

  Fly   363 NGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCG 402
            :|:.:.||||::||.::|.::........:...|::.|||
Human   123 DGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/148 (24%)
PPIANP_066953.1 cyclophilin_ABH_like 4..162 CDD:238907 39/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.