powered by:
Protein Alignment CG3492 and PPIL3
DIOPT Version :9
Sequence 1: | NP_611914.1 |
Gene: | CG3492 / 37902 |
FlyBaseID: | FBgn0035007 |
Length: | 404 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_115861.1 |
Gene: | PPIL3 / 53938 |
HGNCID: | 9262 |
Length: | 165 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 32/69 - (46%) |
Gaps: | 8/69 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 324 EVLNHGVDAGILSFPSRYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGH 388
|.|.|.| .|::|..: .|.......|.|::.....|:.:...||||..|::.|:.:: .
Human 81 EYLKHNV-RGVVSMAN---NGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELE----K 137
Fly 389 LPMS 392
||::
Human 138 LPVN 141
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0652 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.