DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and ppif

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001244029.1 Gene:ppif / 493394 XenbaseID:XB-GENE-1008626 Length:200 Species:Xenopus tropicalis


Alignment Length:178 Identity:33/178 - (18%)
Similarity:61/178 - (34%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS---SAIVFNRALAPIWMEGRLA 307
            |.:|:|: |.:.:..||:..:|..:..|:....|..:||....   ....|:|.:.....:|   
 Frog    39 PMVYMDL-VADNQPLGRVTFELRADVVPKTAENFRALCTGEKGFGYKGSTFHRIIPNFMCQG--- 99

  Fly   308 MDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRY---------------VRGNARTAVN---FTI 354
                         .||  .||....|...:.||:               ...||....|   |.|
 Frog   100 -------------GDF--TNHNGTGGKSIYGSRFPDENFFLKHTGPGVVSMANAGPNTNGSQFFI 149

  Fly   355 SFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTDCG 402
            .......|:.:.:.||.::.|..::::|:............:.:.:||
 Frog   150 CTVETEWLDNKHVVFGCIKDGYDIMKKIESFGSKTGRPSKKVVVAECG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 30/159 (19%)
ppifNP_001244029.1 cyclophilin_ABH_like 39..197 CDD:238907 31/176 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.