DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and NKTR

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001336053.1 Gene:NKTR / 4820 HGNCID:7833 Length:1463 Species:Homo sapiens


Alignment Length:202 Identity:45/202 - (22%)
Similarity:74/202 - (36%) Gaps:73/202 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS-----------SAIVFNRALA 298
            |||.:.|||:....: ||::.|||::.||:....|:.:|:....           ....|:|.:.
Human     6 RPQCHFDIEINREPV-GRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVK 69

  Fly   299 PIWMEGRLAMDPQRSTELTNIEHDFE--------------------VLNHGVDAGILSFPSRYVR 343
            ...::|                .||.                    :|.|. .|.:||..:   |
Human    70 NFMIQG----------------GDFSEGNGKGGESIYGGYFKDENFILKHD-RAFLLSMAN---R 114

  Fly   344 GNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNL-----------IS 397
            |.......|.|:.||...|:|..:.||.|..|.:::|:|:          ||           :.
Human   115 GKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIE----------NLKTDAASRPYADVR 169

  Fly   398 LTDCGVI 404
            :.||||:
Human   170 VIDCGVL 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 36/169 (21%)
NKTRNP_001336053.1 cyclophilin 7..174 CDD:320812 41/197 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..591
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 607..627
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 658..1072
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1129..1156
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1169..1215
Arg/Ser tandem repeat-rich 1311..1348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.