DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and AgaP_AGAP012376

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:XP_001238262.1 Gene:AgaP_AGAP012376 / 4577663 VectorBaseID:AGAP012376 Length:175 Species:Anopheles gambiae


Alignment Length:155 Identity:38/155 - (24%)
Similarity:61/155 - (39%) Gaps:25/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 GVLCKLLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWM 302
            |:..||.:|..     |......|.|.|:|:.:..|.....|..:..:...:...|:|.:....:
Mosquito    11 GIPDKLWQPHF-----VAFETTMGELTIELYWKHAPNTCRNFAELARRGYYNGTQFHRIIRDFMV 70

  Fly   303 EGRLAMDP----------QRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNFTISFK 357
            :|.   ||          ..:|....|..|   |.| ..|||:|..:   .|.......|.|:..
Mosquito    71 QGG---DPTGTGRGGQSIYGATFADEIHSD---LKH-TGAGIVSMAN---SGPDTNGSQFFITLG 125

  Fly   358 PLSILNGRRIAFGKVRKGMQLLERI 382
            |...|:|:...||::..|||:::||
Mosquito   126 PTQWLDGKHTIFGRIHTGMQVVKRI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/144 (24%)
AgaP_AGAP012376XP_001238262.1 cyclophilin 25..169 CDD:294131 33/136 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.