DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Moca-cyp

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:185 Identity:39/185 - (21%)
Similarity:68/185 - (36%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 RPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNS-----------SAIVFNRALA 298
            ||:.:.||.:....: ||::.:||.:..|:....|..:||....           ..::|:|.:.
  Fly    12 RPRCFFDISLGGLGM-GRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIFHRVVK 75

  Fly   299 PIWME-----------GRLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYVRGNARTAVNF 352
            ...::           |..........|....:||...|        ||..:   ||.......|
  Fly    76 DFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFL--------LSMAN---RGKNTNGSQF 129

  Fly   353 TISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNLISLTD-----CG 402
            .|:.:|...|:...:.||:|..|.:|:.:::    .||:..|...|.|     ||
  Fly   130 FITTQPAPHLDNIHVVFGQVISGQELVRQLE----GLPVDRNSRPLQDAAIANCG 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 30/160 (19%)
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 36/182 (20%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.