DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG5071

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster


Alignment Length:378 Identity:77/378 - (20%)
Similarity:142/378 - (37%) Gaps:110/378 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HQRLIPVPTSRRTMPKIRSHIV----MNEQRELYRQHRDRMSNIK-GKVNTYLPPPKVQIEGNGM 137
            |:.|.|.|   ..:|:.|..:|    .|..||:  :..|.:..|: .:..|...||   .:|:..
  Fly   354 HRNLTPDP---ELLPEPRRAVVPPHFNNSLREV--ELLDYVQQIELEQFRTLSQPP---YDGSHE 410

  Fly   138 ELSYMEMLTALYKKSN-----------NTLRTFTKSPERLAAGRWRNANLAREKERRQLEKNKEF 191
            ..|.....::...:||           ..:|...:.|::          :.:|::::|.:.::..
  Fly   411 SSSSPNSSSSTNSQSNYIALDTEYGLRELVRQLQQQPQQ----------VQQEQQQQQQQVHQLT 465

  Fly   192 HKGGELFDPEAGKSKRYKPKSSGSFSCEIPMHVLHRYENLMDQCDVGVLCKLL---RPQIYLDIE 253
            |   .::.|:|......:|:..|..|     |..||.:. .....|.::.:.:   .|..:||:|
  Fly   466 H---SIYQPDAILVNSVEPQLIGQQS-----HDHHRQDG-GTSSSVSIVRQPIVHCYPIYFLDME 521

  Fly   254 VREARIQGRLIIQLFTEACPQVVLEF-----------MRICTQNNSSAIVFNRALAPIWMEGRLA 307
            : ...:.||::|::.::|.|::...|           .|.||       ||.     .|....: 
  Fly   522 I-AGELAGRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCT-------VFQ-----AWGGESI- 572

  Fly   308 MDPQRSTELTNIEHDFEVLNHGVDAGILSFPSRYV-----------------RGNARTAVNFTIS 355
                       |..|||..|.  ..|..:|.|||.                 ||..|...:..:.
  Fly   573 -----------ITGDFESQNG--RGGHSAFESRYFLPDETGLPAHRGTVGMRRGQRRQDRSGFVG 624

  Fly   356 FKPLSILNGRR---IAFGKVRKGMQLLERIQV---AVGHLPMSHNLISLTDCG 402
            .:...:||..|   ..||.:.:|::|::||..   |:|. |...::|  .:||
  Fly   625 SQFRLVLNEMRSFTAIFGFIVQGIELVDRIAASGNALGR-PALRSII--RNCG 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 38/172 (22%)
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 42/189 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.