DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG5808

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_651291.1 Gene:CG5808 / 42957 FlyBaseID:FBgn0027617 Length:653 Species:Drosophila melanogaster


Alignment Length:147 Identity:34/147 - (23%)
Similarity:59/147 - (40%) Gaps:34/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 GRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRAL-----------------APIW--MEGRL 306
            |.|.:.||....|...|.|:::|.....:..:|:...                 :.||  :||  
  Fly    10 GDLTVDLFISERPIACLNFLKLCRLKYYNFNLFHTVQQGFIAQTGDPSGAGDGGSSIWGVVEG-- 72

  Fly   307 AMDPQRSTELTNIEHDF-EVLNHGVDAGILSFPSRYVRGNARTAVNFTISF-KPLSILNGRRIAF 369
               ||:..    .|.:| ..:||. .||:||..|   .|.......|.::. :.|:.|:|.....
  Fly    73 ---PQKRF----FEAEFLPKINHS-SAGMLSLVS---AGKNLVGSQFFLTLGENLTSLDGNHCVI 126

  Fly   370 GKVRKGMQLLERIQVAV 386
            |:|.:|.::|.::..|:
  Fly   127 GEVVEGHEVLRKLNDAI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/147 (23%)
CG5808NP_651291.1 cyclophilin_RRM 4..169 CDD:238902 34/147 (23%)
RRM <237..445 CDD:223796
RRM_PPIL4 237..319 CDD:240681
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.