DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and CG8336

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:204 Identity:46/204 - (22%)
Similarity:70/204 - (34%) Gaps:66/204 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 KLLR------PQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQN-------------- 286
            ||||      |.:||||.:.: ...||:||:|..:..|:....|..:||..              
  Fly     5 KLLRAVKSTNPLVYLDISIGK-EDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKG 68

  Fly   287 ------------NSSAIVFNRALAPIWMEGRLAMDPQRSTELTNIEHDFEVLNHGVDAGILSFPS 339
                        .|..:|.|..     ..|.....|....|...:.|:.|        |::|. :
  Fly    69 TKFHKIKRVFVVQSGDVVKNDG-----SSGESIYGPVFDDENFELSHNEE--------GVVSM-A 119

  Fly   340 RYVRGNARTAVNFTISFKPLSILNGRRIAFGKVRKGMQLLERIQVAVGHLPMSHNL--------- 395
            .|.:.|:..: .|.||......|||..:..|:|.:|:.::..         |..|.         
  Fly   120 NYGKPNSNNS-QFFISAAGCENLNGTNVVVGRVLRGLGIVAE---------MEQNCTDEGDPTAP 174

  Fly   396 ISLTDCGVI 404
            |.:.|||.|
  Fly   175 IVIRDCGEI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 34/164 (21%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 39/190 (21%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.