DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3492 and Cypl

DIOPT Version :9

Sequence 1:NP_611914.1 Gene:CG3492 / 37902 FlyBaseID:FBgn0035007 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster


Alignment Length:153 Identity:36/153 - (23%)
Similarity:66/153 - (43%) Gaps:21/153 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 GVLCKLLRPQIYLDIEVREARIQGRLIIQLFTEACPQVVLEFMRICTQNNSSAIVFNRALAPIWM 302
            |:..|..:|. ::.:|..    .|.:.::|:.:..|.....|..:..:...:.:||:|.:....:
  Fly    12 GIPDKAWQPH-FVTLETS----MGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMI 71

  Fly   303 EGRLAMDP----QRSTELTNIEHDFEVLNHG----VDAGILSFPSRYVRGNARTAVNFTISFKPL 359
            :|.   ||    :....:...|...|:  ||    ..|||||..:   .|.......|.|:..|.
  Fly    72 QGG---DPTGTGRGGASIYGSEFADEL--HGDLRHTGAGILSMAN---SGPDTNGSQFFITLAPT 128

  Fly   360 SILNGRRIAFGKVRKGMQLLERI 382
            ..|:|:...||:|..||::::||
  Fly   129 QWLDGKHTIFGRVYTGMEVVKRI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3492NP_611914.1 cyclophilin 249..388 CDD:294131 33/142 (23%)
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.